NOX1 Blocking Peptide

• Catalog name: 33R-8868
• Supplier name: fitzgerald
• Size: 100 µg
• Price: 210.00€
• Check this product
• Category Proteins
• Antibody Subtype Blocking Peptides
• Area of research Signal Transduction
• Residues STIATSHPKSVVGVFLCGPRTLAKSLRKCCHRYSSLDPRKVQFYFNKENF
• Type of protein Synthetic
• Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.
• Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.
• Shipping conditions Blue Ice
• Tested for WB; IHC
• Test You can block the antibody by the specific target amino acid sequence of peptide.
• Properties blocking peptide