NOX1 Blocking Peptide

  • Catalog name: 33R-8868
  • Supplier name: fitzgerald
  • Size: 100 µg
  • Price: 210.00€
  • Check this product
  • Category Proteins
  • Antibody Subtype Blocking Peptides
  • Area of research Signal Transduction
  • Residues STIATSHPKSVVGVFLCGPRTLAKSLRKCCHRYSSLDPRKVQFYFNKENF
  • Type of protein Synthetic
  • Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.
  • Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.
  • Shipping conditions Blue Ice
  • Tested for WB; IHC
  • Test You can block the antibody by the specific target amino acid sequence of peptide.
  • Properties blocking peptide