Type of Immunogen
NOX1 antibodies were raised using the C terminal of NOX1 corresponding to a region with amino acids STIATSHPKSVVGVFLCGPRTLAKSLRKCCHRYSSLDPRKVQFYFNKENF
Raised in
Rabbit
Specificity
NOX1 antibody was raised against the C terminal of NOX1
Cross Reactivity
Human,Dog
Method of Purification
Affinity purified
Concentration
1 mg/ml
Form & Buffer
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NOX1 antibody in PBS
Storage
Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
Shipping conditions
Blue Ice
Tested for
WB
Usage Recommendations
WB: 0.5 ug/ml
Assay Information
NOX1 Blocking Peptide, catalog no. 33R-8868, is also available for use as a blocking control in assays to test for specificity of this NOX1 antibody
Additional Information
This is a rabbit polyclonal antibody against NOX1, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at [email protected]
Properties
If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.