KIAA1191 antibody

  • Catalog name: 70R-4315
  • Supplier name: fitzgerald
  • Size: 50 µg
  • Price: 475.00€
  • Check this product
  • Category Primary Antibody
  • Antibody Subtype Polyclonal Antibodies, Purified
  • Area of research Neuroscience
  • Type of Immunogen KIAA1191 antibodies were raised using the middle region of KIAA1191 corresponding to a region with amino acids TPHSSPKQRPRGWFTSGSSTALPGPNPSTMDSGSGDKDRNLSDKWSLFGP
  • Raised in Rabbit
  • Specificity KIAA1191 antibody was raised against the middle region of KIAA1191
  • Cross Reactivity Human
  • Method of Purification Affinity purified
  • Concentration 1 mg/ml
  • Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KIAA1191 antibody in PBS
  • Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
  • Shipping conditions Blue Ice
  • Tested for WB
  • Usage Recommendations WB: 1 ug/ml
  • Assay Information KIAA1191 Blocking Peptide, catalog no. 33R-9222, is also available for use as a blocking control in assays to test for specificity of this KIAA1191 antibody
  • Additional Information This is a rabbit polyclonal antibody against KIAA1191, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at [email protected]
  • Properties If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
  • French translation anticorps