Type of Immunogen NRG1 antibodies were raised using the N terminal of NRG1 corresponding to a region with amino acids YMCKVISKLGNDSASANITIVESNEIITGMPASTEGAYVSSESPIRISVS
Raised in Rabbit
Specificity NRG1 antibody was raised against the N terminal of NRG1
Cross Reactivity Human
Method of Purification Affinity purified
Concentration 1 mg/ml
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NRG1 antibody in PBS
Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
Shipping conditions Blue Ice
Tested for WB
Usage Recommendations WB: 1 ug/ml
Assay Information NRG1 Blocking Peptide, catalog no. 33R-10187, is also available for use as a blocking control in assays to test for specificity of this NRG1 antibody
Additional Information This is a rabbit polyclonal antibody against NRG1, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at antibodies@fitzgerald-fii.com
Properties If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.