NOX1 Blocking Peptide
- Catalog name: 33R-8868
- Supplier name: fitzgerald
- Size: 100 µg
- Price: 210.00€
- Category Proteins
- Antibody Subtype Blocking Peptides
- Area of research Signal Transduction
- Residues STIATSHPKSVVGVFLCGPRTLAKSLRKCCHRYSSLDPRKVQFYFNKENF
- Type of protein Synthetic
- Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.
- Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.
- Shipping conditions Blue Ice
- Tested for WB; IHC
- Test You can block the antibody by the specific target amino acid sequence of peptide.
- Properties blocking peptide