NONO antibody

  • Catalog name: 70R-1316
  • Supplier name: fitzgerald
  • Size: 100 µg
  • Price: 389.00€
  • Category Primary Antibody
  • Antibody Subtype Polyclonal Antibodies, Purified
  • Area of research DNA & RNA
  • Type of Immunogen NONO antibodies were raised using the C terminal of NONO corresponding to a region with amino acids DGTLGLTPPTTERFGQAATMEGIGAIGGTPPAFNRAAPGAEFAPNKRRRY
  • Raised in Rabbit
  • Specificity NONO antibody was raised against the C terminal of NONO
  • Cross Reactivity Human,Dog
  • Method of Purification Total IgG Protein A purified
  • Concentration 1 mg/ml
  • Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of NONO antibody in PBS
  • Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
  • Shipping conditions Blue Ice
  • Tested for WB; IHC
  • Usage Recommendations WB: 1.25 ug/ml; IHC: 4-8 ug/ml
  • Assay Information NONO Blocking Peptide, catalog no. 33R-1969, is also available for use as a blocking control in assays to test for specificity of this NONO antibody
  • Additional Information This is a rabbit polyclonal antibody against NONO. It was validated on Western Blot and immunohistochemistry. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at antibodies@fitzgerald-fii.com
  • Properties If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
  • French translation anticorps