Rabbit ENOX1 antibody

  • Catalog name: 70R-4808
  • Supplier name: fitzgerald
  • Size: 50 ug
  • Price: 495.00€
  • Check this product
  • Applications WB
  • Product Type Primary Antibodies
  • Product Subtype Purified Polyclonal Antibodies
  • Research Area DNA & RNA
  • Immunogen ENOX1 antibody was raised using the middle region of ENOX1 corresponding to a region with amino acids QQLQFLQQTMQGMQQQLLTIQEELNNKKSELEQAKEEQSHTQALLKVLQE
  • Specificity ENOX1 antibody was raised against the middle region of ENOX1
  • Cross Reactivity Human,Mouse,Rat
  • Clone NA
  • Concentration 1 mg/ml
  • Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ENOX1 antibody in PBS
  • Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
  • Shipping Info Blue Ice
  • Properties If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
  • About Rabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
  • Latin name Oryctolagus cuniculus
  • French translation anticorps