TOX Blocking Peptide

  • Catalog name: 33R-1732
  • Supplier name: fitzgerald
  • Size: 100 ug
  • Price: 280.00€
  • Check this product
  • Product Type Proteins
  • Product Subtype Blocking Peptides
  • Research Area DNA & RNA
  • Tag/Conjugate CLDPYYCNKFDGENMYMSMTEPSQDYVPASQSYPGPSLESEDFNIPPITP
  • Type1 Synthetic
  • Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.
  • Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.
  • Applications WB, IHC
  • Shipping Info Blue Ice
  • Test You can block the antibody by the specific target amino acid sequence of peptide.
  • Properties blocking peptide