ENOX2 Blocking Peptide

• Catalog name: 33R-10225
• Supplier name: fitzgerald
• Size: 100 ug
• Price: 280.00€
• Check this product
• Product Type Proteins
• Product Subtype Blocking Peptides
• Research Area Cell Biology
• Tag/Conjugate YRIRLGSSTDKKDTGRLHVDFAQARDDLYEWECKQRMLAREERHRRRMEE
• Type1 Synthetic
• Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.
• Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.
• Applications WB, IHC
• Shipping Info Blue Ice
• Test You can block the antibody by the specific target amino acid sequence of peptide.
• Properties blocking peptide